HSPA12A (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 405~435 amino acids from the Central region of human HSPA12A |
HSPA12A (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 405~435 amino acids from the Central region of human HSPA12A |
Rabbit Polyclonal Anti-HSPA12A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HSPA12A Antibody is: synthetic peptide directed towards the N-terminal region of Human HSPA12A. Synthetic peptide located within the following region: KALEIFAYALQYFKEQALKELSDQAGSEFENSDVRWVITVPAIWKQPAKQ |