Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HSPA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA6 antibody: synthetic peptide directed towards the middle region of human HSPA6. Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV |
Carrier-free (BSA/glycerol-free) HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HSPA6 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 474-643 of human HSPA6 (NP_002146.2). |
| Modifications | Unmodified |
HspA6/A7 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from the Internal region of human HSP77/76. |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- HSPA6