Germany
Japan
United Kingdom
China
Hsp20 (HSPB6) mouse monoclonal antibody, clone HSP20-11, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Rat |
Antibodies
View as table DownloadRabbit Polyclonal Anti-HSPB6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPB6 antibody: synthetic peptide directed towards the middle region of human HSPB6. Synthetic peptide located within the following region: ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS |
Rabbit Polyclonal HSP20 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HSP20 |
Rabbit Polyclonal Phospho-HSP20 (Ser16) Antibody (Phospho-specific)
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human HSP20 around the phosphorylation site of Serine 16. |
| Modifications | Phospho-specific |
HSP20/HSPB6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human HSP20/HSP20/HSPB6 (NP_653218.1). |
| Modifications | Unmodified |
HSP20/HSPB6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human HSP20/HSP20/HSPB6 (NP_653218.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HSPB6