Antibodies

View as table Download

Rabbit Polyclonal Anti-Hspb7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Hspb7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTF

Rabbit Polyclonal Anti-Hspb7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Hspb7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TFAHKCQLPEDVDPTSVTSALREDGSLTIRARRNPHTEHVQQTFRTEIKI

Carrier-free (BSA/glycerol-free) HSPB7 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HSPB7 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPB7.

HSPB7 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HSPB7 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated