Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HSP105 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSP105 Antibody: A synthesized peptide derived from human HSP105 |
Rabbit polyclonal Hsp110 Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rat, Sheep, Yeast, Cow |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the sequence of hamster Hsp110; sequence identical to human and mouse |
Rabbit Polyclonal Anti-HSPH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPH1 antibody: synthetic peptide directed towards the middle region of human HSPH1. Synthetic peptide located within the following region: EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ |
Anti-HSPH1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 105kDa/110kDa protein 1 |
Anti-HSPH1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 105kDa/110kDa protein 1 |
Hsph1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
HSPH1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HSPH1 |
HSPH1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HSPH1 |
HSPH1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse HSPH1 |
HSP105/HSPH1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 659-858 of human HSP105/HSP105/HSPH1 (NP_006635.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HSPH1