Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-5-HT-1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-5-HT-1A Antibody: A synthesized peptide derived from human 5-HT-1A |
Antibodies
View as table Download
Rabbit Polyclonal Anti-5-HT-1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-5-HT-1A Antibody: A synthesized peptide derived from human 5-HT-1A |
Rabbit polyclonal Anti-5-Hydroxytryptamine Receptor 1A
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide KKSLNGQPGSGDWRRC, corresponding to amino acid residues 251-266 of rat 5-Hydroxytryptamine Receptor 1A (Accession P19327). 3rd intracellular loop. |
Goat Anti-Htr1a Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ERKNERTAEAKRK, from the internal region of the protein sequence according to NP_032334.2. |
Rabbit polyclonal anti-5-HT-1A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 5-HT-1A. |
Rabbit Polyclonal Anti-HTR1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR1A antibody: synthetic peptide directed towards the N terminal of human HTR1A. Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC |
Rabbit Polyclonal Anti-HTR1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR1A antibody: synthetic peptide directed towards the N terminal of human HTR1A. Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC |
Anti-5HT1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 140-153 amino acids of Human 5-hydroxytryptamine receptor 1A |
HTR1A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HTR1A |
| Modifications | Unmodified |
Active filters
Target Symbol
- HTR1A