Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against Serotonin receptor 1B / HTR1B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNEDFKQAFHK, from the C Terminus of the protein sequence according to NP_000854.1. |
Rabbit Polyclonal Anti-5-Hydroxytryptamine Receptor 1B (extracellular)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CSAKDYIYQDSISLPWK, corresponding to amino acid residues 33-49 of human 5-Hydroxytryptamine Receptor 1B . Extracellular, N-terminus. |
Rabbit Polyclonal Anti-HTR1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR1B antibody: synthetic peptide directed towards the N terminal of human HTR1B. Synthetic peptide located within the following region: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKV |
Rabbit Polyclonal 5-HT1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This antibody was generated by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 8-26 and 263-278 of rat 5-HT1BR (Accession number P28564) |
HTR1B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HTR1B. |
Active filters
Target Symbol
- HTR1B