Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-HTR3A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HTR3A |
Goat Polyclonal Antibody against Serotonin receptor 3A / HTR3A
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GPQDFEKSPRDR, from the internal region of the protein sequence according to NP_998786.1; NP_000860.1. |
Rabbit polyclonal anti-5-HT-3A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 5-HT-3A. |
Rabbit Polyclonal 5-HT3A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 27-42 (RATQAHSTTQPALLRL) and 427-442 (LSSIRHSLEKRDEMRE) of rat 5-HT3 Receptor, accession number P35563. |
5HT3A receptor (HTR3A) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-HTR3A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR3A antibody: synthetic peptide directed towards the N terminal of human HTR3A. Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV |
5HT3A receptor (HTR3A) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 37-66 amino acids from the N-terminal region of Human Serotonin receptor 3A (HTR3A) |
Rabbit polyclonal Anti-5-Hydroxytryptamine Receptor 3A
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RPVPDWLRHLVLDR, corresponding to amino acid residues 342-355 of rat 5-Hydroxytryptamine Receptor 3A (Accession P35563). 2nd intracellular loop. |
Rabbit Polyclonal Anti-Htr3a Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Htr3a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRH |
HTR3A Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human 5-HT-3A. AA range:161-210 |
Active filters
Target Symbol
- HTR3A