5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-HTR7 antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HTR7. |
5HT7 Receptor (HTR7) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
5HT7 Receptor (HTR7) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 404-433 amino acids from the C-terminal region of Human Serotonin receptor 7 (HTR7). |
Goat Anti-HTR7 / 5-HT7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QNADYCRKKGHDS, from the C Terminus of the protein sequence according to NP_000863.1. |
Rabbit Polyclonal Anti-HTR7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI |
Rabbit Polyclonal Anti-HTR7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI |
Rabbit Polyclonal 5-HT7 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Canine |
Conjugation | Unconjugated |
Immunogen | This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 13-28 of the rat 5-HT7R (AAA42134.1). |
Rabbit Polyclonal Anti-HTR7 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | HTR7 / 5-HT7 Receptor antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human 5HT7 Receptor. Percent identity with other species by BLAST analysis: Human, Marmoset, Dog (100%); Mouse, Rat, Hamster, Panda (95%); Gorilla, Pig (90%); Horse (85%). |
Rabbit Polyclonal Anti-HTR7 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | HTR7 / 5-HT7 Receptor antibody was raised against synthetic 14 amino acid peptide from N-terminus of human 5HT7 Receptor. Percent identity with other species by BLAST analysis: Human, Marmoset, Dog (100%). |