Rabbit Polyclonal Anti-HCFC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HCFC1 antibody is: synthetic peptide directed towards the N-terminal region of Human HCFC1. Synthetic peptide located within the following region: MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGG |
Rabbit polyclonal anti-HCFC1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HCFC1. |
Rabbit Polyclonal Anti-HCFC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HCFC1 antibody: synthetic peptide directed towards the N terminal of human HCFC1. Synthetic peptide located within the following region: GTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGH |
Rabbit Polyclonal Anti-HCFC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HCFC1 antibody: synthetic peptide directed towards the middle region of human HCFC1. Synthetic peptide located within the following region: ARNEKGYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKSKADG |
HCFC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human HCFC1 (NP_005325.2). |
Germany
Japan
United Kingdom
China
