Rabbit Polyclonal Anti-HDAC6 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HDAC6 |
Rabbit Polyclonal Anti-HDAC6 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HDAC6 |
Rabbit Polyclonal Anti-HDAC6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | HDAC6 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human HDAC6 |
Rabbit Polyclonal Anti-TENM1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TENM1 antibody was raised against an 18 amino acid peptide near the amino terminus of human TENM1. |
HDAC6 (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | HDAC6 antibody was raised against synthetic peptide |
Rabbit anti-HDAC6 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HDAC6 |
Rabbit Polyclonal Anti-HDAC6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HDAC6 Antibody: A synthesized peptide derived from human HDAC6 |
Rabbit Polyclonal Anti-HDAC6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HDAC6 Antibody: A synthesized peptide derived from human HDAC6 |
HDAC6 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Rabbit Polyclonal HDAC6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC6 |
Rabbit Polyclonal Anti-Hdac6 Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hdac6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac6. Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM |
Rabbit polyclonal anti-HDAC6 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human HDAC6. |
Rabbit Polyclonal HDAC6 (Ser22) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC6 around the phosphorylation site of Serine 22 |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-HDAC6 antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HDAC6 antibody: synthetic peptide directed towards the N terminal of human HDAC6. Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ |
Rabbit Polyclonal HDAC6 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human HDAC6 protein (between residues 1175-1215) [UniProt Q9UBN7] |
Goat Anti-HDAC6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-AHQNKFGEDMPHPH, from the C Terminus of the protein sequence according to NP_006035.2. |
Rabbit Polyclonal HDAC6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody was generated by immunizing rabbits with a synthetic peptide corresponding to amino acids 1-16 of human HDAC6. |
Carrier-free (BSA/glycerol-free) HDAC6 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC6 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC6 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC6 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC6 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC6 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC6 mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC6 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Hdac6 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Rat |
HDAC6 Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 836-1104 of human HDAC6 (NP_006035.2). |
Modifications | Unmodified |
HDAC6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 836-1104 of human HDAC6 (NP_006035.2). |
Modifications | Unmodified |
HDAC6 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
HDAC6 mouse monoclonal antibody, clone 1D10, Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
HDAC6 mouse monoclonal antibody, clone 1D10, HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
HDAC6 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HDAC6 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDAC6 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Biotin |
HDAC6 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | HRP |
HDAC6 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HDAC6 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
HDAC6 mouse monoclonal antibody, clone 4C5, Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Biotin |
HDAC6 mouse monoclonal antibody, clone 4C5, HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | HRP |
HDAC6 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HDAC6 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
HDAC6 mouse monoclonal antibody, clone 1D11, Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Biotin |
HDAC6 mouse monoclonal antibody, clone 1D11, HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | HRP |
HDAC6 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HDAC6 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDAC6 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Biotin |
HDAC6 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | HRP |
HDAC6 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HDAC6 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDAC6 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
HDAC6 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |