Rabbit Polyclonal Anti-HDLBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDLBP antibody: synthetic peptide directed towards the N terminal of human HDLBP. Synthetic peptide located within the following region: MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEK |
Rabbit Polyclonal Anti-HDLBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDLBP antibody: synthetic peptide directed towards the middle region of human HDLBP. Synthetic peptide located within the following region: RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV |
HDLBP Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1035-1268 of human HDLBP (NP_976221.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
