Rabbit Polyclonal Anti-Hebp2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Hebp2 antibody is: synthetic peptide directed towards the N-terminal region of RAT Hebp2. Synthetic peptide located within the following region: EMPSWKAPENIDPQPGSYEIRHYGPAKWVSTCVESLDWDSAIQTGFTKLN |
HEBP2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HEBP2 |
HEBP2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human HEBP2 (NP_055135.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
