Rabbit Polyclonal Anti-HERC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HERC3 antibody is: synthetic peptide directed towards the middle region of Human HERC3. Synthetic peptide located within the following region: LHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDYPGEDVEETFCLN |
HERC3 Antibody - N-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HERC3 |
HERC3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human HERC3 (NP_055421.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China