Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HES5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HES5 |
Rabbit Polyclonal Anti-HES5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HES5 antibody: synthetic peptide directed towards the middle region of human HES5. Synthetic peptide located within the following region: AASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAH |
Carrier-free (BSA/glycerol-free) HES5 mouse monoclonal antibody,clone OTI6F7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HES5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic Peptide of human HES5 |
| Modifications | Unmodified |
HES5 mouse monoclonal antibody,clone OTI6F7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HES5 mouse monoclonal antibody,clone OTI6F7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
HES5 mouse monoclonal antibody,clone OTI6F7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HES5 mouse monoclonal antibody,clone OTI6F7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- HES5