Antibodies

Jump to Filters
View as table Download
HEXIM2 Rabbit Polyclonal Antibody
TA343990

USD 475.00

5 Days

Rabbit Polyclonal Anti-HEXIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEXIM2 antibody: synthetic peptide directed towards the N terminal of human HEXIM2. Synthetic peptide located within the following region: MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES
HEXIM2 Rabbit Polyclonal Antibody
TA366599

USD 380.00

4 Weeks

HEXIM2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human HEXIM2
HEXIM2 Rabbit Polyclonal Antibody
TA377004

USD 220.00

3 Weeks

HEXIM2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 147-286 of human HEXIM2 (NP_653209.1).
Modifications Unmodified