Antibodies

View as table Download

Rabbit Polyclonal Anti-HMGB2 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the middle region of human HMGB2. Synthetic peptide located within the following region: DREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLS

HMGB2 mouse monoclonal antibody, clone 3D2

Applications ELISA, IF, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-HMGB2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the middle region of human HMGB2. Synthetic peptide located within the following region: SEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE

HMGB2 mouse monoclonal antibody, clone 3C7

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-HMGB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the C terminal of human HMGB2. Synthetic peptide located within the following region: AAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE

Rabbit polyclonal HMGB2 Antibody (Center)

Applications WB
Reactivities Human (Predicted: Rat, Bovine, Pig)
Conjugation Unconjugated
Immunogen This HMGB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 92-118 amino acids from the Central region of human HMGB2.

Anti-HMGB2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 166-180 amino acids of Human high mobility group box 2

HMGB2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HMGB2.
Modifications Unmodified

HMGB2 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HMGB2