Antibodies

Jump to Filters
View as table Download
HNRPH3 (HNRNPH3) Rabbit Polyclonal Antibody
TA343782

USD 410.00

5 Days

Rabbit Polyclonal Anti-HNRPH3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPH3 antibody: synthetic peptide directed towards the N terminal of human HNRPH3. Synthetic peptide located within the following region: DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY
HNRPH3 (HNRNPH3) Rabbit Polyclonal Antibody
TA359768

USD 360.00

5 Days

HNRNPH3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HNRNPH3