Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 30 of 30 results

(reset)

hnRNP L (HNRNPL) Rabbit Polyclonal Antibody

TA345781

USD 475.00

5 Days

Rabbit Polyclonal Anti-HNRPL Antibody

Applications	IF, IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

hnRNP L (HNRNPL) Rabbit Polyclonal Antibody

TA345708

USD 410.00

5 Days

Rabbit Polyclonal Anti-HNRPL Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD

1 / 2

2 / 2

Previous Next

hnRNP L (HNRNPL) Rabbit Polyclonal Antibody

TA345780

USD 410.00

5 Days

Rabbit Polyclonal Anti-HNRPL Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: RRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGG

1 / 2

2 / 2

Previous Next

hnRNP L (HNRNPL) Rabbit Polyclonal Antibody

TA311674

USD 345.00

In Stock

Rabbit polyclonal anti-hnRNP L antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from N-terminal of human hnRNP L.

1 / 3

2 / 3

3 / 3

Previous Next

hnRNP L (HNRNPL) Rabbit Polyclonal Antibody

TA347944

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-hnRNP L Antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-hnRNP L Antibody: A synthesized peptide derived from human hnRNP L

hnRNP L (HNRNPL) Rabbit Polyclonal Antibody

AP18050PU-N

USD 450.00

2 Weeks

hnRNP L (HNRNPL) rabbit polyclonal antibody

Applications	WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide selected from the Center region of human HNRPL

hnRNP L (HNRNPL) (C-term) Rabbit Polyclonal Antibody

AP18051PU-N

USD 450.00

2 Weeks

hnRNP L (HNRNPL) (C-term) rabbit polyclonal antibody

Applications	WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide selected from the C-terminal region of human HNRPL

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

CF805417

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HNRNPL mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI9G7]

CF805445

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HNRNPL mouse monoclonal antibody, clone OTI9G7 (formerly 9G7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI4E5]

CF805576

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HNRNPL mouse monoclonal antibody, clone OTI4E5 (formerly 4E5)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI9F11]

CF805577

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HNRNPL mouse monoclonal antibody, clone OTI9F11 (formerly 9F11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

hnRNP L (HNRNPL) Rabbit Polyclonal Antibody

TA351252

USD 345.00

In Stock

Rabbit Polyclonal Anti-HNRNPL Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human HNRNPL

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

hnRNP L (HNRNPL) Rabbit Polyclonal Antibody

TA377168

USD 220.00

3 Weeks

HNRNPL Rabbit polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 282-589 of human HNRNPL (NP_001524.2).
Modifications	Unmodified

hnRNP L (HNRNPL) Rabbit Polyclonal Antibody

TA377169

USD 220.00

3 Weeks

HNRNPL Rabbit polyclonal Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 282-589 of human HNRNPL (NP_001524.2).
Modifications	Unmodified

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

TA805417

USD 379.00

In Stock

HNRNPL mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]

TA805417AM

USD 420.00

4 Weeks

HNRNPL mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E4]

TA805417BM

USD 420.00

4 Weeks

HNRNPL mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

TA805417S

USD 159.00

2 Days

HNRNPL mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI9G7]

TA805445

USD 379.00

In Stock

HNRNPL mouse monoclonal antibody, clone OTI9G7 (formerly 9G7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G7]

TA805445AM

USD 420.00

4 Weeks

HNRNPL mouse monoclonal antibody, clone OTI9G7 (formerly 9G7), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9G7]

TA805445BM

USD 420.00

4 Weeks

HNRNPL mouse monoclonal antibody, clone OTI9G7 (formerly 9G7), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI9G7]

TA805445S

USD 159.00

2 Days

HNRNPL mouse monoclonal antibody, clone OTI9G7 (formerly 9G7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI4E5]

TA805576

USD 379.00

In Stock

HNRNPL mouse monoclonal antibody, clone OTI4E5 (formerly 4E5)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E5]

TA805576AM

USD 420.00

4 Weeks

HNRNPL mouse monoclonal antibody, clone OTI4E5 (formerly 4E5), Biotinylated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E5]

TA805576BM

USD 420.00

4 Weeks

HNRNPL mouse monoclonal antibody, clone OTI4E5 (formerly 4E5), HRP conjugated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI4E5]

TA805576S

USD 159.00

2 Days

HNRNPL mouse monoclonal antibody, clone OTI4E5 (formerly 4E5)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI9F11]

TA805577

USD 379.00

In Stock

HNRNPL mouse monoclonal antibody, clone OTI9F11 (formerly 9F11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9F11]

TA805577AM

USD 420.00

4 Weeks

HNRNPL mouse monoclonal antibody, clone OTI9F11 (formerly 9F11), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F11]

TA805577BM

USD 420.00

4 Weeks

HNRNPL mouse monoclonal antibody, clone OTI9F11 (formerly 9F11), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI9F11]

TA805577S

USD 159.00

2 Days

HNRNPL mouse monoclonal antibody, clone OTI9F11 (formerly 9F11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

1 - 30 of 30 results