Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HOXA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXA9 antibody: synthetic peptide directed towards the middle region of human HOXA9. Synthetic peptide located within the following region: KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE |
Rabbit Polyclonal HOXA9 Antibody
| Applications | IHC |
| Reactivities | Canine, Chicken, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 180-230 of human HOXA9 was used as the immunogen for this antibody. |
HOXA9 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human HOXA9 |
HOXA9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human HOXA9 (NP_689952.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HOXA9