Rabbit Polyclonal Anti-HP1BP3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HP1BP3 antibody: synthetic peptide directed towards the middle region of human HP1BP3. Synthetic peptide located within the following region: QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL |
Rabbit Polyclonal Anti-HP1BP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HP1BP3 antibody: synthetic peptide directed towards the N terminal of human HP1BP3. Synthetic peptide located within the following region: SEESVSTVEEQENETPPATSSEAEQPKGEPENEEKEENKSSEETKKDEKD |
Germany
Japan
United Kingdom
China