Antibodies

Jump to Filters
View as table Download
HSD17B12 (Center) Rabbit Polyclonal Antibody
AP52110PU-N

USD 450.00

2 Weeks

HSD17B12 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 133~163 amino acids from the Center region of human 17-beta-HSD12 / HSD17B12
HSD17B12 Rabbit Polyclonal Antibody
TA341998

USD 375.00

5 Days

Rabbit Polyclonal Anti-Hsd17b12 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hsd17b12 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hsd17b12. Synthetic peptide located within the following region: SAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS
HSD17B12 Rabbit Polyclonal Antibody
TA350058

USD 345.00

In Stock

Rabbit Polyclonal Anti-HSD17B12 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HSD17B12
HSD17B12 Rabbit Polyclonal Antibody
TA359656

USD 360.00

5 Days

HSD17B12 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human DHB12
HSD17B12 Rabbit Polyclonal Antibody
TA364839

USD 380.00

4 Weeks

HSD17B12 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HSD17B12
HSD17B12 Rabbit Polyclonal Antibody
TA377233

USD 220.00

3 Weeks

HSD17B12 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 43-312 of human HSD17B12 (NP_057226.1).