Antibodies

View as table Download

Rabbit Polyclonal Anti-HSD17B14 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD17B14 antibody: synthetic peptide directed towards the middle region of human HSD17B14. Synthetic peptide located within the following region: QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP

Rabbit Polyclonal Anti-HSD17B14 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD17B14 antibody: synthetic peptide directed towards the N terminal of human HSD17B14. Synthetic peptide located within the following region: RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD

Rabbit Polyclonal Anti-HSD17B14 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human HSD17B14

HSD17B14 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HSD17B14