Antibodies

Jump to Filters
View as table Download
HSPA12A (Center) Rabbit Polyclonal Antibody
AP52119PU-N

USD 450.00

2 Weeks

HSPA12A (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 405~435 amino acids from the Central region of human HSPA12A
HSPA12A Rabbit Polyclonal Antibody
TA333659

USD 375.00

5 Days

Rabbit Polyclonal Anti-HSPA12A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HSPA12A Antibody is: synthetic peptide directed towards the N-terminal region of Human HSPA12A. Synthetic peptide located within the following region: KALEIFAYALQYFKEQALKELSDQAGSEFENSDVRWVITVPAIWKQPAKQ