Antibodies

View as table Download

Mouse Monoclonal anti-Hsp70 Antibody

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the N terminal of human HSPA4. Synthetic peptide located within the following region: PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the middle region of human HSPA4. Synthetic peptide located within the following region: PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human HSPA4

HSPA4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human HSPA4