Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HTR3B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT |
Goat Anti-Serotonin Receptor 3B / HTR3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNYLQTQDQTDQQE, from the internal region (near C-terminus) of the protein sequence according to NP_006019.1. |
Rabbit polyclonal Anti-5-Hydroxytryptamine Receptor 3B (extracellular)
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)HIRQSSAGDFAQIR, corresponding to amino acid residues 213-226 of rat 5-Hydroxytryptamine Receptor 3B (Accession Q9JJ16). Extracellular, N-terminus. |
Rabbit Polyclonal Anti-HTR3B Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HTR3B |
HTR3B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-238 of human HTR3B (NP_006019.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HTR3B