Germany
Japan
United Kingdom
China
ICOSL / B7-H2 Mouse Monoclonal (2D3) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Mouse Monoclonal Anti-ICOSLG Antibody, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
LOC102723996 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 216-246 amino acids from the C-terminal region of human CD275 / ICOS Ligand |
Rabbit Polyclonal Anti-ICOSLG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ICOSLG antibody is: synthetic peptide directed towards the N-terminal region of Human ICOSLG. Synthetic peptide located within the following region: VDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-ICOSLG Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 70-84 amino acids of human inducible T-cell co-stimulator ligand |
Rabbit Polyclonal Anti-ICOSLG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ICOSLG |
ICOSL Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-256 of human ICOSL (NP_056074.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- ICOSLG