Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ID4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ID4. |
Rabbit Polyclonal Anti-ID4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ID4 antibody: synthetic peptide directed towards the middle region of human ID4. Synthetic peptide located within the following region: CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP |
Rabbit Polyclonal Anti-ID4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ID4 antibody: synthetic peptide directed towards the N terminal of human ID4. Synthetic peptide located within the following region: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARC |
Carrier-free (BSA/glycerol-free) ID4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ID4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-ID4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 19-38 amino acids of Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein |
Anti-ID4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 19-38 amino acids of Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein |
ID4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ID4 |
ID4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ID4 (NP_001537.1). |
ID4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ID4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ID4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ID4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ID4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ID4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ID4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ID4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ID4