Antibodies

Jump to Filters
View as table Download
IDH2 Rabbit Polyclonal Antibody
TA346571

USD 475.00

5 Days

Rabbit Polyclonal Anti-IDH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IDH2 antibody: synthetic peptide directed towards the middle region of human IDH2. Synthetic peptide located within the following region: GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK
IDH2 Rabbit Polyclonal Antibody
TA308664

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to IDH2 (isocitrate dehydrogenase 2 (NADP+), mitochondrial)

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant fragment corresponding to a region within amino acids 56 and 345 of IDH2 (Uniprot ID#P48735)
IDH2 Goat Polyclonal Antibody
TA311223

USD 375.00

In Stock

Goat Anti-IDH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CIHGLSNVKLNE, from the internal region of the protein sequence according to NP_002159.2.
IDH2 Rabbit Polyclonal Antibody
TA319664

USD 430.00

2 Weeks

Rabbit Polyclonal IDH2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2.
IDH2 Mouse Monoclonal Antibody [Clone ID: 5F11]
AM20902PU-N

USD 480.00

2 Weeks

IDH2 mouse monoclonal antibody, clone 5F11

Applications ELISA, IHC, WB
Reactivities Human
IDH2 Rabbit Polyclonal Antibody
TA336931

USD 424.00

5 Days

Rabbit Polyclonal IDH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human IDH2 protein (between residues 375-452) [UniProt P48735].
IDH2 Rabbit Polyclonal Antibody
TA350076

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-IDH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IDH2
IDH2 Rabbit Polyclonal Antibody
TA364848

USD 380.00

4 Weeks

IDH2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IDH2
IDH2 Rabbit Polyclonal Antibody
TA377321

USD 410.00

3 Weeks

IDH2 Rabbit polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 193-452 of human IDH2 (NP_002159.2).
Modifications Unmodified
IDH2 Rabbit Monoclonal Antibody [Clone ID: R01-7E4]
TA384479

USD 380.00

4 Weeks

IDH2 Rabbit monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated