INDOL1 (IDO2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 267-295 amino acids from the C-terminal region of Human IDO2 / INDOL1 |
INDOL1 (IDO2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 267-295 amino acids from the C-terminal region of Human IDO2 / INDOL1 |
Mouse monoclonal anti-IDO2 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IDO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IDO2 antibody is: synthetic peptide directed towards the C-terminal region of Human IDO2. Synthetic peptide located within the following region: LITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILH |
Goat Anti-IDO2 / INDOL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RDKTLESILHPR, from the C Terminus of the protein sequence according to NP_919270.2. |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody,clone OTI2B9
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody, clone OTI11B2 (formerly 11B2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody, clone OTI6G3 (formerly 6G3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody, clone OTI12G4 (formerly 12G4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody, clone OTI6C6 (formerly 6C6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody, clone OTI19F8 (formerly 19F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IDO2 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IDO2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
IDO2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
IDO 2 Rabbit polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human IDO2. AA range:101-150 |
IDO2 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4), Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4), HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
IDO2 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IDO2 mouse monoclonal antibody,clone OTI2B9
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IDO2 mouse monoclonal antibody,clone OTI2B9
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IDO2 mouse monoclonal antibody, clone OTI11B2 (formerly 11B2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI11B2 (formerly 11B2), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI11B2 (formerly 11B2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
IDO2 mouse monoclonal antibody, clone OTI11B2 (formerly 11B2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IDO2 mouse monoclonal antibody, clone OTI6G3 (formerly 6G3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI6G3 (formerly 6G3), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI6G3 (formerly 6G3), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
IDO2 mouse monoclonal antibody, clone OTI6G3 (formerly 6G3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IDO2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
IDO2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IDO2 mouse monoclonal antibody, clone OTI12G4 (formerly 12G4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI12G4 (formerly 12G4), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI12G4 (formerly 12G4), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
IDO2 mouse monoclonal antibody, clone OTI12G4 (formerly 12G4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IDO2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
IDO2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IDO2 mouse monoclonal antibody, clone OTI6C6 (formerly 6C6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI6C6 (formerly 6C6), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDO2 mouse monoclonal antibody, clone OTI6C6 (formerly 6C6), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
IDO2 mouse monoclonal antibody, clone OTI6C6 (formerly 6C6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IDO2 mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |