Antibodies

Jump to Filters
View as table Download
IFI44L Rabbit Polyclonal Antibody
TA339304

USD 310.00

5 Days

Rabbit Polyclonal Anti-IFI44L Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFI44L antibody: synthetic peptide directed towards the N terminal of human IFI44L. Synthetic peptide located within the following region: MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
IFI44L Rabbit Polyclonal Antibody
TA377336

USD 220.00

3 Weeks

IFI44L Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IFI44L (NP_006811.2).
Modifications Unmodified