Germany
Japan
United Kingdom
China
IFIH1 Rabbit Polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit polyclonal IFIH1 (MDA5) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human IFIH1. |
Goat Polyclonal Antibody against IFIH1 (MDA5)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SNGYSTDENFRYL-C, from the N Terminus of the protein sequence according to NP_071451.2. |
Rabbit Polyclonal Anti-IFIH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFIH1 antibody: synthetic peptide directed towards the middle region of human IFIH1. Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody, clone OTI8C10 (formerly 8C10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody, clone OTI11C11 (formerly 11C11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody,clone OTI12A6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IFIH1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human IFIH1 (NP_071451.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI8C10 (formerly 8C10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI8C10 (formerly 8C10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI8C10 (formerly 8C10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI8C10 (formerly 8C10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI3E10 (formerly 3E10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI3E10 (formerly 3E10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI11C11 (formerly 11C11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI11C11 (formerly 11C11), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI11C11 (formerly 11C11), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI11C11 (formerly 11C11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IFIH1 mouse monoclonal antibody,clone OTI12A6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
IFIH1 mouse monoclonal antibody,clone OTI12A6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
IFIH1 mouse monoclonal antibody,clone OTI12A6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
IFIH1 mouse monoclonal antibody,clone OTI12A6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- IFIH1