Rabbit Polyclonal Anti-IFIT5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFIT5 antibody: synthetic peptide directed towards the middle region of human IFIT5. Synthetic peptide located within the following region: ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE |
Rabbit polyclonal anti-IFIT5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IFIT5. |
Rabbit Polyclonal Anti-IFIT5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFIT5 antibody: synthetic peptide directed towards the N terminal of human IFIT5. Synthetic peptide located within the following region: LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA |
Germany
Japan
United Kingdom
China
