Rabbit polyclonal IFNA4 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IFNA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 162-189 amino acids from the C-terminal region of human IFNA4. |
Rabbit Polyclonal Anti-IFNA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA4 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA4. Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
Germany
Japan
United Kingdom
China