Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-IFNGR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNGR1 |
IFNGR1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 460-489 amino acids from the C-terminal region of human IFNGR1 |
Rabbit Polyclonal Anti-IFNGR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNGR1 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNGR1. Synthetic peptide located within the following region: EVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVS |
IFNGR1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human IFNGR1 |
Recombinant Anti-IFN-gamma receptor 1 (Clone GR20)
| Applications | Bl, FC, Neutralize |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-IFN-gamma receptor 1 (Clone GR20)
| Applications | Bl, FC, Neutralize |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- IFNGR1