Germany
Japan
United Kingdom
China
IFNGR2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IFNGR2 |
Antibodies
View as table Download
Mouse Anti-Human IFN gamma Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rat Anti-Mouse IFN gamma Purified (50 ug)
| Applications | ELISA |
| Reactivities | Mouse |
Mouse Anti-Human IFN gamma Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rat Anti-Mouse IFN gamma Purified (500 ug)
| Reactivities | Mouse |
Rabbit Polyclonal Anti-IFNGR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNGR2 antibody: synthetic peptide directed towards the middle region of human IFNGR2. Synthetic peptide located within the following region: WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL |
Mouse anti IFN gamma Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IFNGR2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IFNGR2 |
IFNGR2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human IFNGR2 (NP_005525.2). |
| Modifications | Unmodified |
IFNGR2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human IFNGR2 (NP_005525.2). |
| Modifications | Unmodified |
IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- IFNGR2