Antibodies

View as table Download

Rabbit Polyclonal Anti-IL28RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF

Rabbit Polyclonal Anti-IL28RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV

Carrier-free (BSA/glycerol-free) IFNLR1 mouse monoclonal antibody,clone OTI3D5

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IFNLR1 mouse monoclonal antibody,clone OTI1B1

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IFNLR1 mouse monoclonal antibody,clone OTI7B2

Applications WB
Reactivities Human
Conjugation Unconjugated

IFNLR1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IFNLR1

IFNLR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-228 of human IFNLR1 (NP_734464.1).
Modifications Unmodified