Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against IGFBP4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KGELDCHQLADSFRE, from the C Terminus of the protein sequence according to NP_001543.2. |
Antibodies
View as table Download
IGFBP4 mouse monoclonal antibody, clone IBP144
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IGFBP4 mouse monoclonal antibody, clone IBP182
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IGFBP4 mouse monoclonal antibody, clone IBP190
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IGFBP4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IGFBP4 antibody: synthetic peptide directed towards the middle region of human IGFBP4. Synthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV |
IGFBP4 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of Human IGFBP4. |
Anti-IGFBP4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 22-258 amino acids of human insulin-like growth factor binding protein 4 |
IGFBP4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 178-258 of human IGFBP4 (NP_001543.2). |
| Modifications | Unmodified |
IGFBP4 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-258 of human IGFBP4 (NP_001543.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IGFBP4