Antibodies

Jump to Filters
View as table Download
IGSF22 Rabbit Polyclonal Antibody
TA590371

USD 409.00

In Stock

Rabbit Polyclonal IGSF22 Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
IGSF22 Rabbit Polyclonal Antibody
TA337352

USD 375.00

5 Days

Rabbit Polyclonal Anti-IGSF22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IGSF22 antibody is: synthetic peptide directed towards the N-terminal region of Human IGSF22. Synthetic peptide located within the following region: NKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKM