Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CD316 / IGSF8 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Gorilla, Human, Monkey, Pig, Rabbit |
| Immunogen | CD316 / IGSF8 antibody was raised against synthetic 15 amino acid peptide from internal region of human IGSF8. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Bat, Elephant, Panda, Rabbit, Pig (100%); Mouse, Rat (93%). |
CD316 / IGSF8 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Human, Monkey, Orang-Utan, Rabbit |
| Immunogen | CD316 / IGSF8 antibody was raised against synthetic 15 amino acid peptide from internal region of human IGSF8. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Rabbit (100%); Panda, Bovine, Bat, Pig, Guinea pig (93%); Mouse, Opossum (87%); Elephant (80%). |
Rabbit Polyclonal Anti-IGSF8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IGSF8 antibody: synthetic peptide directed towards the middle region of human IGSF8. Synthetic peptide located within the following region: LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEW |
IGSF8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-350 of human IGSF8 (NP_443100.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IGSF8