Germany
Japan
United Kingdom
China
Goat Anti-IL18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1. |
Antibodies
View as table Download
Rabbit polyclonal Mouse IL-18 antibody
| Applications | IF |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with native 157 aa mouse IL-18 produced in E.coli. |
Rabbit polyclonal anti-IL-18 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 41 of human IL-18 |
Rabbit Polyclonal Anti-IL18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL18 antibody: synthetic peptide directed towards the C terminal of human IL18. Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS |
IL18 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse IL18 |
IL18 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant proteinof human IL18. |
| Modifications | Unmodified |
Recombinant Anti-IL-18 (Clone 125-2H)
| Applications | ELISA, IF, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-IL-18 (Clone 125-2H)
| Applications | ELISA, IF, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-IL-18 (Clone SAIC-24B-4)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- IL18
Filter by
Category
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
- Unmodified (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (1)