Antibodies

View as table Download

Rabbit Polyclonal IL-36G Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-36G antibody was raised against a 13 amino acid peptide near the carboxy terminus of human IL-36G.

Rabbit Polyclonal antibody to IL1F9 (interleukin 1 family, member 9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 105 and 169 of IL1F9 (Uniprot ID#Q9NZH8)

Rabbit Polyclonal Anti-IL36G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL36G Antibody is: synthetic peptide directed towards the middle region of Human IL36G. Synthetic peptide located within the following region: ITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLY

Carrier-free (BSA/glycerol-free) IL1F9 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL1F9 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

IL36G Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of mouse IL36G (NP_705731.2).
Modifications Unmodified

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated