Rabbit Polyclonal IL-36G Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IL-36G antibody was raised against a 13 amino acid peptide near the carboxy terminus of human IL-36G. |
Rabbit Polyclonal IL-36G Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IL-36G antibody was raised against a 13 amino acid peptide near the carboxy terminus of human IL-36G. |
Rabbit Polyclonal antibody to IL1F9 (interleukin 1 family, member 9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 105 and 169 of IL1F9 (Uniprot ID#Q9NZH8) |
Rabbit Polyclonal Anti-IL36G Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL36G Antibody is: synthetic peptide directed towards the middle region of Human IL36G. Synthetic peptide located within the following region: ITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLY |
Carrier-free (BSA/glycerol-free) IL1F9 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL1F9 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL36G Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of mouse IL36G (NP_705731.2). |
Modifications | Unmodified |
IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
IL1F9 mouse monoclonal antibody,clone 2F4, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
IL1F9 mouse monoclonal antibody,clone 2F4, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI6E4 (formerly 6E4), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI6E4 (formerly 6E4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |