Germany
Japan
United Kingdom
China
Antibodies
View as table Download
IL4R rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 460-510 of Human IL-4Rα. |
Rabbit Polyclonal Anti-IL4R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL4R antibody is: synthetic peptide directed towards the C-terminal region of Human IL4R. Synthetic peptide located within the following region: GLDREPPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVD |
IL4R rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IL4R |
IL4R Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-232 of human IL4R (NP_000409.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IL4R