Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat polyclonal anti-p33 ING1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole Goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 285-296 of Human p33 ING1 protein (Inhibitor of growth family, member 1). This sequence shows 100% homology to all splice variants for ING1. |
Rabbit Polyclonal Anti-p33 ING1 Antibody
| Applications | WB |
| Reactivities | Human and Mouse |
| Conjugation | Unconjugated |
| Immunogen | Mouse p33 ING1 N-terminal peptide –KLH conjugates |
Rabbit Polyclonal Anti-ING1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ING1 antibody: synthetic peptide directed towards the N terminal of human ING1. Synthetic peptide located within the following region: SPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGS |
Rabbit Polyclonal Anti-ING1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ING1 antibody: synthetic peptide directed towards the C terminal of human ING1. Synthetic peptide located within the following region: EKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCD |
Rabbit Polyclonal Anti-ING1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ING1 |
ING1 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ING1 |
ING1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ING1 |
ING1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ING1 |
| Modifications | Unmodified |
Active filters
Target Symbol
- ING1