Antibodies

Jump to Filters
View as table Download
PIP3E (IPCEF1) (C-term) Rabbit Polyclonal Antibody
AP52142PU-N

USD 450.00

2 Weeks

PIP3E (IPCEF1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 316-345 amino acids from the C-terminal region of human IPCEF1 / PIP3-E
PIP3E (IPCEF1) Rabbit Polyclonal Antibody
TA339329

USD 375.00

5 Days

Rabbit Polyclonal Anti-PIP3-E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIP3-E antibody: synthetic peptide directed towards the middle region of human PIP3-E. Synthetic peptide located within the following region: IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE
PIP3E (IPCEF1) Rabbit Polyclonal Antibody
TA339330

USD 310.00

5 Days

Rabbit Polyclonal Anti-PIP3-E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIP3-E antibody: synthetic peptide directed towards the C terminal of human PIP3-E. Synthetic peptide located within the following region: DDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSS
PIP3E (IPCEF1) Mouse Monoclonal Antibody [Clone ID: OTI3G2]
CF505252

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IPCEF1 mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications WB
Reactivities Human
Conjugation Unconjugated
PIP3E (IPCEF1) Mouse Monoclonal Antibody [Clone ID: OTI3G2]
TA505252

USD 379.00

In Stock

IPCEF1 mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications WB
Reactivities Human
Conjugation Unconjugated
PIP3E (IPCEF1) Mouse Monoclonal Antibody [Clone ID: OTI3G2]
TA505252S

USD 159.00

2 Days

IPCEF1 mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications WB
Reactivities Human
Conjugation Unconjugated