Antibodies

Jump to Filters
View as table Download
IPMK Rabbit Polyclonal Antibody
TA308405

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to IPMK (inositol polyphosphate multikinase)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 26 and 295 of IPMK (Uniprot ID#Q8NFU5)
IPMK Rabbit Polyclonal Antibody
TA337886

USD 375.00

5 Days

Rabbit Polyclonal Anti-IPMK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IPMK antibody is: synthetic peptide directed towards the middle region of Human IPMK. Synthetic peptide located within the following region: SDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKIL
IPMK Rabbit Polyclonal Antibody
TA312576

USD 345.00

In Stock

Rabbit polyclonal anti-IPMK antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IPMK.