Germany
Japan
United Kingdom
China
Rabbit anti-IPO5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IPO5 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-IPO5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IPO5 Antibody: synthetic peptide directed towards the N terminal of human IPO5. Synthetic peptide located within the following region: GNNQWPEGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIK |
IPO5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IPO5 |
IPO5 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human IPO5 |
IPO5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IPO5 |
IPO5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IPO5 |
IPO5 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RANBP5 |
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
Active filters
Target Symbol
- IPO5