Antibodies

Jump to Filters
View as table Download
Iqgap2 Rabbit Polyclonal Antibody
TA337967

USD 375.00

5 Days

Rabbit Polyclonal Anti-Iqgap2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Iqgap2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Iqgap2. Synthetic peptide located within the following region: DNLKRKNSRRSIKLDGKAEPKGTKRVKPVRYTAAKLHDKGVLLGIDDLQT
IQGAP2 Rabbit Polyclonal Antibody
TA350700

USD 345.00

In Stock

Rabbit Polyclonal Anti-IQGAP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IQGAP2
IQGAP2 Rabbit Polyclonal Antibody
TA366817

USD 380.00

4 Weeks

IQGAP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IQGAP2
IQGAP2 Rabbit Polyclonal Antibody
TA377551

USD 220.00

3 Weeks

IQGAP2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1330-1440 of human IQGAP2 (NP_006624.2).
Modifications Unmodified