Rabbit Polyclonal Anti-IREB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IREB2 antibody: synthetic peptide directed towards the middle region of human IREB2. Synthetic peptide located within the following region: IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK |
Goat Anti-IREB2 / IRP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SIHYEGSEYKLSHGS, from the internal region of the protein sequence according to NP_004127.1. |
IREB2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human IREB2 (NP_004127.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
