Germany
Japan
United Kingdom
China
IRF2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IRF2 |
Antibodies
View as table Download
Goat Polyclonal Antibody against IRF2
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KTSDITQARVKSC, from the C Terminus of the protein sequence according to NP_002190.1. |
Rabbit Polyclonal Anti-IRF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRF2 antibody: synthetic peptide directed towards the N terminal of human IRF2. Synthetic peptide located within the following region: APLFRNRAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKK |
Rabbit Polyclonal Anti-IRF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRF2 antibody: synthetic peptide directed towards the N terminal of human IRF2. Synthetic peptide located within the following region: IEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEP |
IRF2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IRF2 |
IRF2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IRF2 |
IRF2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-349 of human IRF2 (NP_002190.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IRF2